Author Topic: [lang] Li-Ya-Hu  (Read 23492 times)

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
[lang] Li-Ya-Hu
« on: 2011-Apr-02 20:13 »

Liyahu is a constructed language created by Xay Voong during the development of a role-playing video game. The core concepts are based on the trinity entities mind, body, and soul. The philosophy is elemental, rational, metaphysical, semantical, structural, straightforward, compact, and concise.

Character Composition
Letters and numbers are made of up three symbols--called vi--positioned around the skeleton, or skel--called nga. Each skel comprise three rooms, or vc, to hold these symbols. (Note the symbols may be color coded, but not necessary.)
MindBodySoul
liviyavihuvi
bluegreenred
SkelDown skel
ngavi
also mingavi (up skel)
vangavi
lettersnumbers

Alphabet
Letters--called la--are written with mingavi (up skel) arranged either horizontally or vertically.

Vowels
Note: Some Latin consonants are used as vowels when romanizing Liyahu. These are q,j,c, and x. In other words, when you see these letters, treat them as vowels. So in addition to the original a,e,i,o, and u, there are nine vowels.
liyahuleljyqychxho
/i ?//?//u ?//? a//y ?//?//œ ?//? ?//o/
keep
it
hahfood
foot
pet
pat
über
Jyutping
(Cantonese)
lawperm
seung
(Cantonese)
bundletoe

Consonants
lurarhiyiwunyahakhighu
/l//r//?//j//w//??//h//?//?/
lullroarcarros
(Spanish roll)
yaywowpiñahahlochbut
(glottal stop)
ngikagunatudimupiba
/?//k//g//n//t//d//m//p//b/
longingkickgagnuntotdidmompopbob
sitsashuzadzuzhivufitha
/s//t?//?//z//d?//?//v//f//?/
sischurchshushzazjudgevisionvivefifethoth

Numerals
Numbers are written with vangavi (down skel). The empty vangavi is also used to represent zero.
0123456789
hiriwakhumengqnxzhjthcsho

Punctuation
Punctuation marks are written with parts of the ngavi (called kc, sounds like "ker") in any of the eight directions that it is turned. Up is mi, down is va, left is fq, right is pa.
Full stopSpaceComma
fqngavifqkcvivafqkcvi
left-full-skelleft-part-skeldown-left-part-skel


Three-symbol characters
Three-symbol characters represent common, useful, culture-independent words.

Alternative Scripts

Proposal to Omniglot.

Liyhau True-type font file
« Last Edit: 2021-Apr-30 22:48 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Li-Ya-Hu Examples
« Reply #1 on: 2011-Apr-02 23:19 »
Examples of text and numbers written in Liyahu

Liyahu
luliyiyahahu

The quick brown fox jumps over the lazy dog. (English transliteration)
thahxspacekawulikaspacebarayahunaspacefiyqkasispacedzuhxmupisispacehovuycspacethahxspacelulelizalispacediyqgufull stop


Mandarin
tuyilenaspaceshuyiyaspacewulelispaceguhongi
Cantonese
tulinaspacehayaspacewuhxlispaceguhongi

Date this topic was created: 2011/04/02
2011comma04comma02
Apollo 11 Moon Landing: 1969/07/20
1969comma07comma20
U.S. Debt on 2016/12/13 (approximate): $19,885,570,018,988.02
19comma885comma570comma018comma988full stop02

« Last Edit: 2016-Dec-13 06:43 by ADMIN »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Universal Declaration of Human Rights (Article 1)
« Reply #2 on: 2011-Apr-03 15:32 »
All human beings are born free and equal in dignity and rights. They are endowed with reason and conscience and should act towards one another in a spirit of brotherhood. (English transliteration)
yqluspacehayihumulenaspacebalilengisispaceyaraspacebayqranaspacefiralispacelenadispacelikawuhxluspacelinaspacediligunalitulispacelenadispacerahxlitusifull stopthalelispaceyaraspacelenadiyahudispacewulithaspaceralizahxnaspacelenadispacekahonashulilenasispacelenadispaceshuljdispacelekatuspacetuhuwuyaradizaspacewuhxnaspacehxnahothaycspacelinaspacehxspacesipiliralituspacehxvuspacebarahothaychahudifull stop
« Last Edit: 2016-Dec-13 06:50 by ADMIN »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Vocabulary
« Reply #3 on: 2012-Mar-10 20:30 »
li : mind
ya : body
hu : soul
nga : skeleton, frame
kc : bone, part of skeleton or frame
vi : symbol
vc: room (house)
mi : up
va : down
fq : left
pa : right
ka  : show, emote, manifest
ra : influence
kara : charisma, charm
la : letter (alphabet)
gu :  old
shx:  new
shj : event
gushj : story
nof : tell
bxn : fix
ho : yell
mao : cat
khif : water
hus : fire
wao : earth
zxb : air
lj : blue
yq : green
ho : red
ma : mother
dq : father
gi : music
kei : strange
ngc : tooth
tsong : pierce
wezh : two of, liang
gqk : wrath ?
khesh : ruin ?
dzey : money
sots : poison
dza : negative
fu : positive
light : shu
yokh : sun
ngq : eat
werny :  mountain
lerr : abyss
« Last Edit: 2016-Dec-13 04:26 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Structure and Syntax
« Reply #4 on: 2012-Mar-15 21:51 »
Structure
How the trinity fit into and defined by categories.

Symbol
Core conceptMindBodySoul
Nameliviyavihuvi
Colorbluegreenred
TenseFuturePresentPast
PhysicalTime, SpaceMass, EnergyProperty, Phase
PerformanceThought, PlanningAction, ConsequenceSpeech, Motivation
SenseIntuition, PerceptionTouch, BalanceEmotion, Taste
GenderNeutralMasculineFeminine
EnergyElementalBiologicalSpiritual
EfficiencySkill, AccuracyPower, OffenseSpeed, Health
Balanced Ternary-0+


Syntax
Grammar and word constructions and regulations.

Verb-Subject-Object OR Subject-Verb-Object

Letters in a word may be split across lines if they can't all fit in the same line.
« Last Edit: 2021-Apr-30 22:57 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Alternative Scripts
« Reply #5 on: 2012-Oct-30 16:00 »
In addition to official script, there are alternative scripts for different purposes and usage. e.g. writing by hand, digital, rope-like, flags, etc.



Variant 1
Best usage: signal flags
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place




Variant 2
Best usage: handwriting
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place
« Last Edit: 2021-Apr-30 22:58 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Alternative Scripts
« Reply #6 on: 2012-Oct-31 15:30 »
Variant 4
Best usage: handwriting, cursive-like, shorthand
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place




Variant 7
Best usage: handwriting, resembles Liyahu skel
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place
« Last Edit: 2021-Apr-30 22:59 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu: Khuvi (three-symbols)
« Reply #7 on: 2012-Nov-10 22:50 »
Here defines the khuvi or three-symbols.

SymbolPronunciationDefinitionSymbolPronunciationDefinitionSymbolPronunciationDefinition
rhithisbethatluall
raoryiandngiperson
tj'ssiifkhibut
theatfcplacevutime
pcfromnyathingwuhave
thoinshqtokoway
dzjnodzqwithdxother
zaImqyouhahe/she/it
zhxistsoforghuwhich
« Last Edit: 2021-Apr-30 23:03 by Den »
Support me on Patreon

I saw. I conquered. I came.

ADMIN

  • Administrator
  • Member
  • *****
  • Posts: 35
    • View Profile
Re: [lang] Li-Ya-Hu SMF addon test
« Reply #8 on: 2012-Nov-11 03:04 »
Test Liyahu SMF package.

Code: [Select]
[liyahu]words and phrases[/liyahu]
This is a test.
thalisispacelisispacehxspacetulesitufull stop

mother not'her.
muhxthaycspacenayatuhaycfull stop

han sjN yqn
selina ren
De qn kei
hayanaspacesiljngispaceyiyqna
silelulinayaspaceralena
dzulespaceyqnaspacekaleli


When I was back there in seminary school, there was a person there
Who put forth the proposition, that you can petition the lord with prayer
hawulenaspaceyalispacewuhxsispacebalekaspacethaleycspacelinaspacesilemulinaleralispacesikahulucommathaleycspacewuhxsispacehxspacepiycsihxnaspacethaleyc
hahuspacepihutuspacefiyqrathaspacethahxspacepirahopihozalishuhxnacommathayatuspaceyihuspacekalenaspacepiletulishuhxnaspacethahxspaceluyqradispacewulithaspacepiraleyc
« Last Edit: 2016-Dec-13 06:21 by ADMIN »

ADMIN

  • Administrator
  • Member
  • *****
  • Posts: 35
    • View Profile
Re: [lang] Li-Ya-Hu Alternative Scripts
« Reply #9 on: 2014-Jul-17 20:29 »
Variant 11
Best usage: linear direction, knots or strings on a rope
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place




Variant 13
Best usage: Chinese or East Asian feel
Key:


Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place
« Last Edit: 2021-Apr-30 23:10 by Den »

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Alternative Scripts
« Reply #10 on: 2015-May-21 21:36 »
Variant 14
Best usage: Latin-like, simple
Key:


Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place




Variant 16
Best usage: Devanagari-like
Key:

Ex.
Shenafu

Han Sjng Yqn

Selina Ren

Dze Qn Kei

All people have time and place
« Last Edit: 2021-Apr-30 23:11 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #11 on: 2015-May-21 22:30 »
Just realized that Liyahu looks like a field of flowers and grass. The ngavi (skel) looks like stem and leaves and the vi (symbols) like petals of various flowers.
« Last Edit: 2015-May-21 22:36 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu Vangavi
« Reply #12 on: 2015-May-21 23:27 »
Todo: Find uses for vangavi (down skel). such as measurements (distance, time, mass), calendar (days, months),

mind - time, space, distance, perception
body - mass, volume, substance amount, action
soul - energy, nature, electric current, temperature, speech

27 units (3 symbols vakhuvi)
second, minute, hour
day, month, year
point, per cent, degree, radian, kelvin
meter, square meter (acre), cubic meter (liter)
mole, candela, hertz, bel
gram, newton, joule, watt
ampere, volt, ohm
bit, byte


powers of 10 prefixes (2 symbols vawavi)
li 10 deca-
yc 100 hecto-
hx 1,000  kilo-
lj 1,000,000  mega-
yq 1,000,000,000  giga-
hxyq 1,000,000,000,000  tera-
ljyq 1,000,000,000,000,000  peta-
hu 0.1  deci-
le 0.01  centi-
ya 0.001  milli-
ho 0.000 001  micro-
yaho 0.000 000 001  nano-
hoho 0.000 000 000 001  pico-

18 more vawavi
plus, multiply, power
minus, divide, modulus, percent, negative
equal, point, true, false, degree, unit
currency
« Last Edit: 2016-Jan-08 18:13 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #13 on: 2015-Jul-27 14:21 »
Latin font inspired by Liyahu symbols

L2A test page

Alphabet:
Spoiler:
LetterFontBase
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z

Examples:

Liyahu:


Conscipt:
« Last Edit: 2021-Apr-30 23:18 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #14 on: 2015-Sep-04 16:50 »
The Origins of Liyahu

Liyahu began as a gimmick for a conceptual RPG that I've had in mind for a long time. A central theme in this RPG is archaeology. To make things more interesting for the player, I wanted to create a forgotten language used by a long-gone group of people. Players would discover this exotic language as they explore the caves and ruins inhabited by the ancients.

The trinity has always fascinated me since I was a young adult. The idea came from the Dianetics book (I'm not a Scientologist) I read in 1997-98. The main idea that impressed me was the interplay between the three entities of mind, body, and soul. The number 3 is also an important, mystical, and flexible number. It's balanced (cf. rock-paper-scissors, triangle is the sturdiest shape), simple, repeatable, expandable, etc. More recently, I learned about ternary logic and how much better it is than binary (true/false) logic. (Aside, I'm designing a programming language with ternary logic as one of its core.) Also base-3 numbers are actually more efficient than base-2.

Back to Liyahu. The first roadblock is how would my letters in this alphabet look like. I saw other constructed languages based on concepts of 2 and 4. They usually put symbols side by side or in a square. Similarly for my base-3 writing, I decided to divide my letters into three parts. Hence, the skel (short for skeleton) that is shaped like a Y. The letters would be combinations and permutations of smaller symbols arranged around this skel.

The symbols for mind, body, soul came about quite simply. Mind is a vague outline of a (human) brain, separated by left and right halves. Body is an upright (human) body. Soul shows the four chambers of the (human) heart (as well as a cross pertaining to many spiritual philosophies, including ancient Babylon and Egyptian, Christianity, and Hinduism.)

With the symbols set, the next major hurdle is connecting them to the sounds used in speech (in particular, what our human voices can make.) Many alphabets in real-world languages comprise about 20 to 30 letters. Coincidentally, I can fit around that much using single and double symbols: 9 singles and 27 doubles = 36 letters. Thus I reserved 9 single letters for vowels and 27 doubles for consonants.

I sought the 3 most common, yet distinct vowel sounds found in languages around the world, and concluded these were A, I, and U. Then connected them to the trinity: A is the sound of physical release (e.g. when a fighter is about to punch), U is the sound of breathing central to many spiritual activities (e.g. yoga, meditation, hu is also the Mandarin word for exhale), which leaves I for mental activities. Another reason for choosing these 3 vowels, is that according to the IPA vowel chart, these 3 vowels occupy the corners of the chart. So, there is plenty of room between them to locate other lesser vowels and group them closest to the major vowels.

Consonants will contain two symbols in specific permutations. However, repeated symbols are rarer than combined symbols. That is, there are fewer mind-mind permutations than mind-soul. Hence, repeated symbols shall form the basis of consonants. For these, I sought out the glides, semi-glides, and pharyngeal sounds. First, there are fewer of these sounds than 'harder' consonants. Second, it distinguishes this language from real-world languages, which usually form around 'harder' consonants. Third, they sound smoother and less effort to pronounce. Liyahu comes out smoother than say, Bikatu. Also important is how close these sound to the essence of mind, body, soul. YA is the sound of physical release. HU is the sound of breathing. LI is the root of words like 'literature', 'letter', 'library', etc. (Thus I also defined 'li' in this language to mean 'letter'.)

The rest of the consonants are organized by family of sounds according to linguistic theories. Where the sound comes from (throat, nasal, mouth), position of tongue and teeth, voiced, aspiration, etc. Then fit these groups as best with the concepts mind, body, soul, along with the sounds of A, I, U.

The choices of vowels and consonants are highly influenced by English, Cantonese, and Mandarin.

The names of the vowels is simply the base consonant sound--L, Y, or H--plus the vowel sound. For example, E belongs to I group, which is related to L. So L + E = le.

The names of the consonants is simply the consonant sound plus the vowel in the empty position of the symbol. For instance, L is missing the right symbol, which is the default position of the soul symbol, or U. Hence L + U = lu.

The default positions of the symbols situated around the skel is thus: mind at top, body left, and soul right. This has other ramifications for other matters, including 3-symbol letters, word composition, alternative writing systems, structural concepts (such as past, present, future), etc.

Words are created where each letter represents a process and property of that word. For example, the word for fire is 'hus'. H (soul-soul) means it has no physical state. You can't hit it or hold it. U (soul) means it moves around like a breath of air. S (soul-body) means it can warm the body and the heart. Fire also makes a sizzling sound. Thus, individually each letter for the word fire 'hus' and together embodies the essence of fire. (It also sounds very close to the Mandarin word for fire 'huo'.)

The variant writing systems began as a way to facilitate writing Liyahu with pen and paper. Variants 7 and 2 came first. However, the forums posts goes by the order I have in my notebook, where I experiment and practice the different writing systems. I must say, variant 2 is actually quite fun to write with pen and paper (and looks cute to boot). As you said, simple symbols, trimmed to the essential, make things efficient and practical. Then I expanded to wildly other forms of 'writing', although some of these seem more fanciful than practical. Variant 11 is inspired by Phyrexian writing (from Magic: the Gathering card game), through which I learned about ancient Incan communication methods that tied ropes and knots called 'quipu'.

One of my most ambitious, fanciful idea for the RPG is to have different writing systems appear on different parts of the game (i.e. on different worlds and levels).

(Note: This post is a response to Napishtim's questions via PM.)
« Last Edit: 2015-Sep-04 17:51 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #15 on: 2015-Sep-06 02:20 »
MBS 27 Domains Chart

Each Liyahu letter can be divided into three parts, or houses. Each house is dominated by either mind, body, or soul. Which symbol you put in each house will modify or define that house.

The simplest to explain is the left house, dominated by body. For the elements, this house defines what the element looks like or how it is manifested. A mind symbol in the body house means it is imaginary or abstract, only an idea. A body symbol means it has matter and can be felt and seen. A soul symbol means it invisible but has energy or force, or gaseous, or related to emotional or spiritual expression.

This method inducted to all elements, by filling every house with different symbols. Each permutation of houses and symbols forms a unique element.

The most iconic element is that of Man.

The man has a physical body (body symbol in body house), a heart that can feel various emotions (soul symbol in soul house), and has the capacity for thought and advanced mental faculties (mind symbol in mind house). This element's graphic is also the icon for the Liyahu language and philosophy.
« Last Edit: 2021-Jul-17 15:37 by ADMIN »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #16 on: 2016-Aug-13 23:20 »
Simplify sounds for numbers, by digits, pairs, and trips -- in Liyahu's base 3/9/27

* Base 3 - base vowels IAU (no consonants)
* Base 9 - base vowels & vowel diphthongs from IAU (no consonants)
* Base 27 - consonants & vowel diphthongs

* Base 3--
- 0 u, 1 i, 2 a
* Base 9--
- 00 u, 01 ui, 02 ua, 10 iu, 11 i, 12 ia, 20 au, 21 ai, 22 a
* Base 27--
- 0.. h.., 1.. l.., 2.. y..
- ex. 102 lua, 222 ya, 020 hau
- ex. 120,102,002 lau-lua-hua; 212,110,021,220 yia-liu-hai-yau

One and two vi digits = base 36 (=27 double-vi + 9 single-vi). Used to divide cycles, circles, and tell time.
36 seconds per minute, 36 minutes per hour, 36 hours per day, 36 days per month.
10 months per year = 1 big month & 9 small months = 30 months per triade = 27+3 = 40 months between peak years = 27+9+3+1
Big month = extra 5 days. On peak year extra 6 days.


Resources:
* Duodecimal Nomenclature, http://dozenal.org/drupal/sites_bck/default/files/DuodecimalBulletinIssue012-web_0.pdf , p. 4
« Last Edit: 2016-Aug-14 07:57 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #17 on: 2016-Aug-27 14:21 »
Liyahu to use base 12?

Base 12 is one of the more rational bases. Should Liyahu  number system form around base 12? (instead of 3/9/27)  Evenness is very crucial for rational arithmetic, to easily split things in half. If so, how should the symbols (vi) look like?

Liyahu symbols are formed around only 3 houses to place the vi. But the permutations thereof don't directly wholly form 12 symbols needed for digital computation.

Idea: A fourth house at the center of the skel. This means 4 houses and 3 vi in each house = 12 possible digits.
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #18 on: 2016-Dec-13 04:43 »
Liyhau True-type font file

Symbolliyahuleljyqychxho
ASCIIiauejqcxo
Symbollurazayiwunyahakhighu
ASCIIlrRywYhKG
Symbolngikagunatudimupiba
ASCIINkgntdmpb
Symbolsitsashuzadzuzhivufitha
ASCIIsTSzDZvfF
Symbolspacefull stopcommaliyahu
ASCIIspace ( )full stop (.)comma (,)Liyahu (%)

Code: [Select]
[size=32pt][font=liyahu][/font][/size]

Fis is riten in liyahu %.

Code: [Select]
[liyahu][/liyahu]

thalisispacelisispaceralitulenaspacelinaspaceluliyiyahahuspaceliyahufull stop
« Last Edit: 2016-Dec-13 23:44 by ADMIN »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
12 Jungian Archetypes
« Reply #19 on: 2017-Mar-26 06:07 »
https://ieants.cc/wp/12-jungian-archetypes/

The 12 Common Archetypes were conceived by Carl Jung to describe the common personalities and drives in all people.

This table attempts the fit them into my trinity mind/body/soul RPG system. This chart can help better define the roles and personalities of NPCs in the story.


Amazingly, the twelve archetypes also fit the twelve Olympian gods. (Greek mythology is really universal, profound, insightful.)
Innocent  Artemis
Magician  Athena
Caregiver  Demeter
Companion  Hera
Ruler  Zeus
Sage  Apollo
Lover  Aphrodite
Explorer  Poseidon
Creator  Hephaestus
Warrior  Ares
Rebel  Hermes
Jester  Dionysus


Ideally their order could match the Hero's journey, or like tarot major Arcana. In deck of cards with 12 ranks, starting from 0 to 11.
« Last Edit: 2018-Feb-03 03:52 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Re: [lang] Li-Ya-Hu
« Reply #20 on: 2018-Aug-18 21:51 »
Liyahu is a ternary system. It has also been proposed as balanced ternary. Thus it easily follows that ternary logic and divination can also be utilized from Liyahu symbols.

Where
mind, -, false, no
body, 0, uncertain, maybe
soul, +, true, yes

When one asks a question, it returns one of 3 answers: yes, no, maybe.

Divination similar to Ancient Chinese I Ching hexagrams may be represented in Liyahu. Where I Ching had binary trigrams = 2^3 = 8 combinations, here we have 3^3 = 27 combos. They can be simply represented with khuvi. This form already represents the 27 domains; either use the same domains, or alternative metaphors for divination.

A single vi provides a single answer, whereas a khuvi gives insight across 3 phases to provide a grander view of the problem. Such as past-present-future, thought-action-motivation, etc.
« Last Edit: 2018-Aug-18 22:24 by Den »
Support me on Patreon

I saw. I conquered. I came.

Den

  • Global Moderator
  • Hero Member
  • *****
  • Posts: 1357
  • Selina is my Superstar
    • View Profile
    • Amuseum
Karot Reading
« Reply #21 on: 2021-Apr-30 15:37 »
Inspired by last two posts, Liyahu domains have been incorporated as fortune telling system. You can try it at KARA 5 page. Click the "Karot Reading" button to begin, then click "New Reading", and click "Reveal Next Card" to reveal cards one by one.

The deck of cards consist of KARA5 cards (which is 5 suits of 12 ranks), and 27 Domain cards (represented by Liyahu khuvi), for total of 87 cards. White background is normal meaning; yellow background means inverted meaning.

The intended layout of this Karot reading is divided into five phases, to represent the subject, distant past, recent past, present, and future. Each phase consists of a pair of cards. The first card in each pair is the dominating factor of that phase, and the second card in the pair further describes the first card.

The very first card revealed is the subject of the query. Then proceeds to the distant past, recent past, present, and future, before finally revealing the card that completes the subject pair. The last card is the key factor that dominates the subject for this reading's query.

See attachment for meanings of each card. KARA5 cards can be read just like the Tarot cards. The suits match up as so:

KARA5PokerTarot
GoldDiamondPentacle
BlueClubWand
BlackSpadeSword
RedHeartCup
Greenn/an/a


The 5th suit, Green, represents nature, youth, energetic, etc. Four "pretty girl" face cards represent in order "girl", "mistress", "queen", and "goddess" -- which can represent any gender of equivalent age or status. For example, mistress can also mean lord, winner, champion, owner.

The Liyahu domain cards represent abstract, universal, phenomenon. They may be read in different ways: by MBS (mind-body-soul) elements (individual or total); by domain's term directly (e.g. related to Time); by wordplay (e.g. Atom may be a person named Tom).

Example Reading
A sample of a KAROT reading is provided in the spoilers below. Consult the attached image as you read the spoilers.
Spoiler:
The query for this reading is "Who will be the Superbowl Champions in 2022?" This reading was taken soon after Tom Brady and the Tampa Bay Buccaneers won the 2021 SB.

First my notes for this reading, followed by essay.

Notes

{{Subject}}
- Blue Wang - championship game - battle between best warriors
- Green Wang - inverted - not young - oldest player ever to win champion, SB MVP

{{Distant Past}}
- Red Zheng - inverted - 1st SB - ?future, popularity uncertain?
- Fire - inverted - cold - northern team - ?green bay?
{{Recent Past}}
- Blue Five - inverted - Victory after obstacles - good attendance during epidemic
- Man - inverted - explorer = buccaneers, sea, not land - wildcard, underdog
{{Present}}
- Atom - Tom Brady - nucleus of team - quarterback - mental player leads other physical players
- Blue Zheng - best - G.O.A.T. - experience, mental toughness - not physicality
{{Future}}
- Earth - inverted - BBS = two groups compete over ball on turf - ?muddy field?
- Gold Wang - inverted - stagnation - ?repeat winners?

{{Overall Trend}}
- 3 Wang cards = champion - also Zheng, Five (Chinese symbols) resemble Wang symbol = 6 out of 10 cards Wang or Wang-like = challengers of grand contest

Final Interpretation

The first card is the subject of the query, in the center. Namely trying to predict the next Superbowl Champion. The card is a Blue Wang. Wang represents winners, victory. Thus this card is referring to a battle between the best warriors to determine the ultimate victor.

The second card is the top-left card. This is the first card of the distant past phase. The Red Zheng is inverted. Zheng represents one, first, origin, the beginning. This card could be pointing to the first ever Superbowl. Its future and popularity was uncertain. This was when the two leagues, NFL and AFL merged into a single league. They created the Superbowl to determine to best team from both leagues.

The third card is next to the second card, and provides more detail to this phase. The Fire card is inverted, meaning loss of heat. Perhaps it refers to the champion of the the first Superbowl I, when a team that hailed from the northern cold, namely the Green Bay Packers, became the first Superbowl Champions.

The fourth card is the low-left card. This is the first card of the recent past phase. Whereas the previous phase points to a distant past, this phase is much more recent. The Blue Five is inverted. It could mean victory after obstacles. Taking account the contemporary current events, it could mean a good attendance of the championship game despite the epidemic of Coronavirus.

The fifth card is next to the fourth card, and provides more detail to this phase. The Man is inverted. Of the Jungian archetypes, Man domain is associated with the Explorer. The team that just won the SB were called Buccaneers, who by definition travel the seas. Inverted because not explorer of land, but of the water. Inverted could also refer to underdogs. The Bucs were a wildcard team who beat all the other favorite teams to take home the grand prize.

The sixth card is the low-right card. This is the first card of the present phase. The card is Atom. If taken literally, it could refer to a person named Tom -- in this case Tom Brady, the Superbowl MVP. Atom means nucleus. Brady plays the quarterback position, the nucleus of any football team. The Liyahu symbols on Atom is one Mind over two Body. Brady being the oldest player, relied more on his experience to overcome the younger, more physical players. Especially his opposing quarterback, a rising star who was gifted with one of the strongest, most talented throwing arm ever.

The seventh card is next to the sixth card, and provides more detail to this phase. The Blue Zheng. Zheng means #1. Brady with his seventh Superbowl victory and 4th SB MVP award, seals his glory as the football G.O.A.T -- Greatest of All Time. Blue card means he relied on his mental toughness and experience and knowledge, instead of physical domination over his opponents.

The eighth card is top-right card. This is the first card of the future phase. The Earth is inverted. It has two Body symbols and one Soul symbol. It looks like two groups competing over a ball on a turf -- perhaps a muddy field, inclement weather, or dome game.

The ninth card is next to the eighth card, and provides more detail to this phase. The Gold Wang is inverted. It could mean stagnation. Perhaps it is the same winner as the previous season. So maybe the Bucs will win in consecutive years?

The tenth and final card is the center, next to the first card, and provides more detail to the subject. From this card, we get a sense of the overall vibe of the Superbowl in its entirety. The Green Wang is inverted. Inverted green card would mean old, not young. This card may reaffirm the previous cards about Tom Brady. He is the oldest player to win a SB game and SB MVP. He has been the topic of many rumors and scandals in recent years. Many questioned whether he could lead a new team to victory without coach Bill Belichick. With his seventh SB victory with the Bucs, he has answered all the doubts, and cemented himself as the GOAT of football.

Furthermore, also consider the overall trend of the revealed cards. For this reading, we see three Wang cards. Moreover, the Zheng and Five as Chinese symbols, also resemble the Wang symbol. So 6 out 10 cards are Wang or Wang-like. Wang is interpreted as Champion. Thus this reading is all about identifying and acknowledging the champions of football.
« Last Edit: 2021-Jul-17 15:23 by ADMIN »
Support me on Patreon

I saw. I conquered. I came.